PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK15082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 547aa    MW: 60990.7 Da    PI: 4.947
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK15082.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.11.3e-1331765472374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                + lL+ cA+av+++d++ +++l+++l++l+s +gdp+qRl ay++e+L a++a+s+s++ykal+++e +   s+e ++++++++e++P++kf+++ aN a
  PK15082.1 176 KGLLFICAQAVAENDKSTTEWLISELRQLVSVSGDPLQRLSAYMLEGLVAKMASSGSSIYKALRCKEPA---SAELFSYMHILYEICPYFKFGYMSANGA 272
                5689****************************************************************9...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                I eav+ e+ vHiiDf+i qG+QW+ L++aL++Rp+gpp++RiT++++++s   +   le +g rL+k+Ae+++vpfefn+ v +++++++le+L v+pg
  PK15082.1 273 IAEAVKDESVVHIIDFQIVQGAQWMILIHALSTRPGGPPKIRITAIDDSTSAyaRGGGLEIVGLRLSKIAESCKVPFEFNA-VDTSVAEVQLEDLGVRPG 371
                ************************************************998899999************************.799*************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                Ea+aVn++l+lh+++desv ++   +rd++L+l kslsP+vv++veqe+++n+++F  rf+e+++yy+a+f+sl+++lpre++eri+vE+++l+r+ivnv
  PK15082.1 372 EAIAVNFALMLHHMPDESVGSQTpnHRDRLLRLTKSLSPNVVTLVEQELNTNTAPFYSRFVETFNYYMAVFESLDVTLPREHKERINVEQHCLARDIVNV 471
                ******************97766669************************************************************************** PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +ac g er+erhe l+kWr+r+++aGF+p+pls  +++++k+ll++++++ +++ee++g+l+lgW+d++++s +aWr
  PK15082.1 472 IACDGPERVERHEMLGKWRSRFTMAGFRPYPLSPLVNSTIKALLQNYSEK-FTLEERDGALYLGWMDKAMISSCAWR 547
                ************************************************65.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.891149528IPR005202Transcription factor GRAS
PfamPF035144.4E-131176547IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MKESQSYRIS NGSHRFLAQS DEDPESYCWA PIHNIDNLKA ANDSQGSHLA VKTFTQYCTL  60
ESSSGTSSNP VQNSSSSVSF SPNGSPSSQP ETQSYLTYQH LSPDNFCGSP VSHSCLTDDT  120
DDLRHKIREL ESVMQGTDSD FPEMYNISNQ VEQNEVSLEG DNWGRLMDML SASDLKGLLF  180
ICAQAVAEND KSTTEWLISE LRQLVSVSGD PLQRLSAYML EGLVAKMASS GSSIYKALRC  240
KEPASAELFS YMHILYEICP YFKFGYMSAN GAIAEAVKDE SVVHIIDFQI VQGAQWMILI  300
HALSTRPGGP PKIRITAIDD STSAYARGGG LEIVGLRLSK IAESCKVPFE FNAVDTSVAE  360
VQLEDLGVRP GEAIAVNFAL MLHHMPDESV GSQTPNHRDR LLRLTKSLSP NVVTLVEQEL  420
NTNTAPFYSR FVETFNYYMA VFESLDVTLP REHKERINVE QHCLARDIVN VIACDGPERV  480
ERHEMLGKWR SRFTMAGFRP YPLSPLVNST IKALLQNYSE KFTLEERDGA LYLGWMDKAM  540
ISSCAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-621795478375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097275.10.0hypothetical protein L484_009507
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLW9R3X90.0W9R3X9_9R
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein